Calificación registral y su repercusión sobre la naturaleza de los procesos de Usucapion viabilizada vía notarial en el Perú

La presente investigación se ocupó de precisar la manera en que la calificación registral afecta la naturaleza de los procesos de usucapión viabilizadas vía notarial en el Perú. El problema principal del tráfico inmobiliario en el Perú, es la potestad de poder tener un título de propiedad definitivo, saneado, y factible a su inscripción y por consiguiente presta a su oponibilidad frente a terceras personas. La usucapión nace con los preceptos más inherentes del ser humano Como son: derecho a la libertad, a la vida, a la propiedad, entre otros, taxativamente establecidos y reconocidos por la constitución política del estado. La usucapión puede ser sustanciada ante el órgano jurisdiccional, administrativamente y ante las Notarías, precisamente el problema objeto de la presente es la desnaturalización de la calificación registral que efectúan los registradores respecto de los procesos de usucapión tramitadas notarialmente. El registrador debe cumplir con calificar la legalidad de los procedimientos no contenciosos sustanciados notarialmente como si los hubiese tramitado el juez, trastocando el principio rector de legalidad, algunos registradores califican el título; pues, el notario cumple con los requisitos exclusivos para tal viabilización y el registrador muchas veces observa calificando el fondo, cuando la prescripción es meramente declarativa, ya el solicitante de la usucapión ha ganado dicho derecho con la sola posesión por más de diez años y el notario verifica dicha posesión con la constatación in-situ en el lugar materia de usucapión, así como con la contrastación de todos y cada uno de los documentos que acreditan la posesión. El estudio se ha realizado desde un enfoque dogmático teniendo entre sus principales conclusiones la de establecer una directiva aclaratoria al respecto, o también propongo una modificación al reglamento de inscripción de los registros públicos en cuanto a la calificación de los procedimientos de P.A.D. viabilizadas notarialmente; así como sanciones, en caso los señores registradores de manera dolosa, incumplan las normas legales, directivas, precedentes de observancia obligatoria, causando perjuicio a los requirentes y deteniendo el desarrollo económico de una nación.Kay llank’anataqwiruwanayuqutqachiyqasananchaychaninchananpaqqhawasunchis mana sallqakanapaqpachanchiskayruwayninñaruwachunqhawananpaqkukaywasiallinhatunka machiyninkay Perú suyunchispi. Ch’arwikunaqañawpaqñeqepinsasachakuninmobiliarionisqawankay Perú suyupi, kallpachakunkayatipaqumalliqrunakaqpaqch’ullalapa, hallma, mana sasaruwanapaq, usqhayllaqelqanapaq, chaynaqaaynitaapachinqakukinsañeqenrunakunapachinpanpi. Kay millayruwanatapaqariranku manan allinrimaykunatapreceptosnisqakunakayrunamankasqantachayhinaqakanku: hayllialliqkananpaq, allinalliqkawsanapaq, allinalliqtinayanchispaq, hoqkunawanpaq, taxativamentenisqareqsikusunchisallinkusatiyanachispaqallinumalliqkunaqañawinchasp akawsasunchisllipinchis. Kay millayruwanataqaukhupikaqkunaqa mana allinqhawasqaqa mana allinqelqaspaqatukuyrikuyuqqhawanmanwasiallinhatunkamachiynin, chaynaqach’arwikunataqaqhawanañawpaqñeqehamuqpachamanchaninchapawankayalli nqelqanapiqhawananpaq mana millaykananpaqumalliqkunaqaruwanankuwasiallinhatunkamachiyninchaypi. Kamachiyqaruwananllipintaallinqelqanakunataqakamachiqkunata manan contenciososnisqaqhawachinqakunkuskachaqkinranpi, qapisqañawpaqpamantaqseq’echakuspaallinqelqanata, hoq runa kamachiqkunataqaruwankuumalliqchista, chaymantaqakamachiqtaruwankuqelqanatahoqkunataqaqhawanapaqaskhakunatakamac hiqkunataqa, ñamañakuspausucapiónnisqakunakallpachakunp’añañeqeconstataciónnisqawaninsitunisqachunka wata k’itipiumalliqqaqhawankayqelqanarunapausuchin, chaynahinaqacontrastaciónnisqakunaqallipinchistuqraqelqay. Kay yachayqaruwakunñawpaqkunamantaqakawsayninkunapaqdogmáticonisqayaninchakunk uruwankuallinnapakuspakawnanpaq, chuyanchispasqelqankurunapaqñawpaqyachaytupuypi P.A.D. nisqapikayqarunakunapinanayninwanruwankukamachiqkunataallinkawsanchispaqwasia llinhatunkamachiynin mana ch’arwikuspaqelqanachiskamachiqkunataqawasiumalliqpaq.The present investigation has taken place to clarify the manner in which the registered classification affects the naturalization of the viable use processes through notarial deeds in Peru. The main problem of real estate traffic in Peru, is the power of power to have a title of permanent property, sanitation, and factual in its registration and by virtue of its ability to provide for third parties. The use of nacity with the most inherent precepts of the human being as they are: right to liberty, life, property, among others, specifically established and recognized by the constitutional constitutionof the state. The use can be sustained in addition to the jurisdictional, administrative and notary bodies, precisely the problem object of the present is the denaturalization of the registered classification that enforces the registrars in respect of the notarial proceedings. The registrar must complete to classify the legality of the proceedings without the notarial contents as the would have treated the judge, transgressing the principle of rector of legality, some registrars classifying the title; well, the notary complies with the exclusive requisites for the validation and the registrar many times observes calibrating the fund, while the prescription is merely declarative, already the solicitor of the use has won would have derecho with the sole position for more and more notary verifies his position with the in-situ finding in the use matter, as well as with the contrast of all and any of the documents that approve the position. The study was carried out by a dogmatic approach by drawing its main conclusions from the establishment of a directive on declaration of respect, and we also propose a modification to the rules of registration of public registers in accordance with the classification of A.D. procedures. notarially viable; as well as sanctions, in this case the registrars of manner of law, including the legal standards, directives, precedents of mandatory observance, causing perjury to those required and detaining the economic development of a nation

Efecto de la alimentación en el ganado vacuno de raza holstein en la calidad de leche en establos de la jurisdicción San Camilo - La Joya - Arequipa

El presente estudio se realizó en la jurisdicción San Camilo-La Joya-Arequipa, en un periodo de 6 meses. Entre Octubre – Abril del 2017- 2018; con la finalidad de determinar los efectos de la alimentación en el ganado vacuno de raza Holstein evaluando la calidad de leche en establos a través de análisis microbiológico e higiénica sanitaria y fisicoquímicos. En la investigación se utilizaron vacas en producción de raza Holstein con ciclo de producción de 1- 3 partos con peso promedio de 450 – 600 kg, en 4 establos (A, B, C, D). Aplicando 2 sistemas de alimentación (intensiva –semi-intensiva) elaborando cuatro tipos de formulación de concentrados (F1, F2. F3, F4), analizando un total de 64 vacas para sistema intensivo y 22 vacas para el sistema semi-intensivo. Los resultados del estudio reflejan que las diferentes formulaciones realizadas y aplicadas a la dieta de vacas lecheras en producción no presentaron efecto negativo sobre el consumo, digestibilidad y producción de la leche. Volumen de litros promedios de producción (A, B) (32.4 - 25.7) litros; establos (C, D) fue (26.1 – 29.9) litros. Para concluir en las formulaciones de los concentrados se realizó un análisis proximal; determinando que el sistema intensivo la F4 es la mejor formulación: grasa 7.13 %; proteína 19.54% carbohidratos 52.85 %; energía kcal 363.77. Para el sistema de alimentación semi-intensiva F1: grasa 6.52 %; proteína 21.59 %, carbohidratos 48.9 % energía kcal 349.26.Tesi

Global Perspectives on Task Shifting and Task Sharing in Neurosurgery.

BACKGROUND: Neurosurgical task shifting and task sharing (TS/S), delegating clinical care to non-neurosurgeons, is ongoing in many hospital systems in which neurosurgeons are scarce. Although TS/S can increase access to treatment, it remains highly controversial. This survey investigated perceptions of neurosurgical TS/S to elucidate whether it is a permissible temporary solution to the global workforce deficit. METHODS: The survey was distributed to a convenience sample of individuals providing neurosurgical care. A digital survey link was distributed through electronic mailing lists of continental neurosurgical societies and various collectives, conference announcements, and social media platforms (July 2018-January 2019). Data were analyzed by descriptive statistics and univariate regression of Likert Scale scores. RESULTS: Survey respondents represented 105 of 194 World Health Organization member countries (54.1%; 391 respondents, 162 from high-income countries and 229 from low- and middle-income countries [LMICs]). The most agreed on statement was that task sharing is preferred to task shifting. There was broad consensus that both task shifting and task sharing should require competency-based evaluation, standardized training endorsed by governing organizations, and maintenance of certification. When perspectives were stratified by income class, LMICs were significantly more likely to agree that task shifting is professionally disruptive to traditional training, task sharing should be a priority where human resources are scarce, and to call for additional TS/S regulation, such as certification and formal consultation with a neurosurgeon (in person or electronic/telemedicine). CONCLUSIONS: Both LMIC and high-income countries agreed that task sharing should be prioritized over task shifting and that additional recommendations and regulations could enhance care. These data invite future discussions on policy and training programs

High reproducibility of two-dimensional liquid chromatography using pH-driven fractionation with a pressure-resistant electrode.: High reproducibility of two-dimensional liquid chromatography using pH-driven fractionation with a pressure-resistant electrode.

International audienceAutomated two-dimensional liquid chromatography using the PF2D system from Beckman Coulter provides a fractionation platform well suited for differential proteomic studies. To date, the reliability and reproducibility of PF2D has not been accurately tested. Here, we used an optimized software and a pressure-resistant pH electrode, allowing a precise and reproducible control of the pH limits for each fraction during PF2D. We tested the reliability of this improved system by performing several rounds of fractionation using the same protein extract. Three UV maps were generated, leading to 54 chromatograms and more than 3000 protein peaks. Using semi-automated software for peak-to-peak comparison between 2D-LC chromatograms, we demonstrate that the peak concordance is very high. The rates of concordance were higher in the second dimension repeatability tests, indicating that the limiting factors for 2D-LC reproducibility rely on the pI fractionation and sample preparation steps. The reproducibility between maps was closely related to pH curves similarities, further stressing the need of careful pH adjustment and precise electrode calibration

Probing electrical activity of single neurons based on 1D nanostructures: from extra to intracellular interfacing.

International audienceThe struggle against neurodegenerative diseases is one of the major challenges in the near future and the global understanding of these diseases goes through a better expertise at the single cell level of basic mechanisms involved in neuronal networks. We need to investigate closer to the cellular material and in this way, miniaturization of electronic components and emergence of nano-biotechnology open new perspectives. Indeed, we are now able to fabricate high sensitive nano-devices to follow neuronal activities. Here, we will present two different approaches to interface neurons, a first one based on a nano-FET for extracellular recordings and a second one using vertical nanowire arrays (nano-electrodes) for intracellular measurements

Effect of tryptase inhibition on joint inflammation: a pharmacological and lentivirus-mediated gene transfer study

BACKGROUND: Increasing evidences indicate that an unbalance between tryptases and their endogenous inhibitors, leading to an increased proteolytic activity, is implicated in the pathophysiology of rheumatoid arthritis. The aim of the present study was to evaluate the impact of tryptase inhibition on experimental arthritis. METHODS: Analysis of gene expression and regulation in the mouse knee joint was performed by RT-qPCR and in situ hybridization. Arthritis was induced in male C57BL/6 mice with mBSA/IL-1β. Tryptase was inhibited by two approaches: a lentivirus-mediated heterologous expression of the human endogenous tryptase inhibitor, sperm-associated antigen 11B isoform C (hSPAG11B/C), or a chronic treatment with the synthetic tryptase inhibitor APC366. Several inflammatory parameters were evaluated, such as oedema formation, histopathology, production of IL-1β, -6, -17A and CXCL1/KC, myeloperoxidase and tryptase-like activities. RESULTS: Spag11c was constitutively expressed in chondrocytes and cells from the synovial membrane in mice, but its expression did not change 7 days after the induction of arthritis, while tryptase expression and activity were upregulated. The intra-articular transduction of animals with the lentivirus phSPAG11B/C or the treatment with APC366 inhibited the increase of tryptase-like activity, the late phase of oedema formation, the production of IL-6 and CXCL1/KC. In contrast, neutrophil infiltration, degeneration of hyaline cartilage and erosion of subchondral bone were not affected. CONCLUSIONS: Tryptase inhibition was effective in inhibiting some inflammatory parameters associated to mBSA/IL-1β-induced arthritis, notably late phase oedema formation and IL-6 production, but not neutrophil infiltration and joint degeneration. These results suggest that the therapeutic application of tryptase inhibitors to rheumatoid arthritis would be restrained to palliative care, but not as disease-modifying drugs. Finally, this study highlighted lentivirus-based gene delivery as an instrumental tool to study the relevance of target genes in synovial joint physiology and disease.status: publishe

Treatment of adult chronic indeterminate Chagas disease with benznidazole and three E1224 dosing regimens: a proof-of-concept, randomised, placebo-controlled trial

Background: Chagas disease is a major neglected vector-borne disease. In this study, we investigated the safety and efficacy of three oral E1224 (a water-soluble ravuconazole prodrug) regimens and benznidazole versus placebo in adult chronic indeterminate Chagas disease. Method: In this proof-of-concept, double-blind, randomised phase 2 clinical trial, we recruited adults (18–50 years) with confirmed diagnosis of Trypanosoma cruzi infection from two outpatient units in Bolivia. Patients were randomised with a computer-generated randomisation list, which was stratified by centre and used a block size of ten. Patients were randomly assigned (1:1:1:1:1) to five oral treatment groups: high-dose E1224 (duration 8 weeks, total dose 4000 mg), low-dose E1224 (8 weeks, 2000 mg), short-dose E1224 (4 weeks + 4 weeks placebo, 2400 mg), benznidazole (60 days, 5 mg/kg per day), or placebo (8 weeks, E1224-matched tablets). Double-blinding was limited to the E1224 and placebo arms, and assessors were masked to all treatment allocations. The primary efficacy endpoint was parasitological response to E1224 at the end of treatment, assessed by PCR. The secondary efficacy endpoints were parasitological response to benznidazole at end of treatment, assessed by PCR; sustainability of parasitological response until 12 months; parasite clearance and changes in parasite load; incidence of conversion to negative response in conventional and non-conventional (antigen trypomastigote chemiluminescent ELISA [AT CL-ELISA]) serological response; changes in levels of biomarkers; and complete response. The primary analysis population consisted of all randomised patients by their assigned treatment arms. This trial is registered with ClinicalTrials.gov, number NCT01489228. Findings: Between July 19, 2011, and July 26, 2012, we screened 560 participants with confirmed Chagas disease, of whom 231 were enrolled and assigned to high-dose E1224 (n=45), low-dose E1224 (n=48), short-dose E1224 (n=46), benznidazole (n=45), or placebo (n=47). Parasite clearance was observed with E1224 during the treatment phase, but no sustained response was seen with low-dose and short-dose regimens, whereas 13 patients (29%, 95% CI 16·4–44·3) had sustained response with the high-dose regimen compared with four (9%, 2·4–20·4) in the placebo group (p<0·0001). Benznidazole had a rapid and sustained effect on parasite clearance, with 37 patients (82%, 67·9–92·0) with sustained response at 12-month follow-up. After 1 week of treatment, mean quantitative PCR repeated measurements showed a significant reduction in parasite load in all treatment arms versus placebo. Parasite levels in the low-dose and short-dose E1224 groups gradually returned to placebo levels. Both treatments were well tolerated. Reversible, dose-dependent liver enzyme increases were seen with E1224 and benznidazole. 187 (81%) participants developed treatment-emergent adverse events and six (3%) developed treatment-emergent serious adverse events. Treatment-emergent adverse events were headaches, nausea, pruritus, peripheral neuropathy, and hypersensitivity. Interpretation: E1224 is the first new chemical entity developed for Chagas disease in decades. E1224 displayed a transient, suppressive effect on parasite clearance, whereas benznidazole showed early and sustained efficacy until 12 months of follow-up. Despite PCR limitations, our results support increased diagnosis and access to benznidazole standard regimen, and provide a development roadmap for novel benznidazole regimens in monotherapy and in combinations with E1224. Funding: Drugs for Neglected Diseases initiative.Fil: Torrico, Faustino. Universidad Mayor de San Simon Bolivia; Bolivia. Fundación Ceades; BoliviaFil: Gascon, Joaquim. Instituto de Salud Global de Barcelona; EspañaFil: Ortiz, Lourdes. Universidad Autónoma Juan Misael Saracho de Tarija; BoliviaFil: Alonso Vega, Cristina. Drugs For Neglected Diseases Initiative; SuizaFil: Pinazo, María-Jesús. Instituto de Salud Global de Barcelona; EspañaFil: Schijman, Alejandro Gabriel. Consejo Nacional de Investigaciones Científicas y Técnicas. Instituto de Investigaciones en Ingeniería Genética y Biología Molecular "Dr. Héctor N. Torres"; ArgentinaFil: Almeida, Igor C. University of Texas at El Paso; Estados UnidosFil: Alves, Fabiana. Drugs For Neglected Diseases Initiative; SuizaFil: Strub-Wourgaft, Nathalie. Drugs For Neglected Diseases Initiative; SuizaFil: Ribeiro, Isabela. Drugs For Neglected Diseases Initiative; SuizaFil: Santina, Glaucia. Drugs For Neglected Diseases Initiative; SuizaFil: Blum, Bethania. Drugs For Neglected Diseases Initiative; SuizaFil: Correia, Erika. Drugs For Neglected Diseases Initiative; SuizaFil: García Bournissen, Facundo. Consejo Nacional de Investigaciones Científicas y Técnicas; Argentina. Gobierno de la Ciudad de Buenos Aires. Hospital General de Niños "Ricardo Gutiérrez"; ArgentinaFil: Vaillant, Michel. Competence Center in Methodology and Statistics; LuxemburgoFil: Ramos Morales, Jimena. Platform for Comprehensive Care of Patients with Chagas Disease; BoliviaFil: Pinto Rocha, Jimy Jose. Platform for Comprehensive Care of Patients with Chagas Disease; BoliviaFil: Rojas Delgadillo, Gimena. Platform for Comprehensive Care of Patients with Chagas Disease; BoliviaFil: Magne Anzoleaga, Helmut Ramon. Platform for Comprehensive Care of Patients with Chagas Disease; BoliviaFil: Mendoza, Nilce. Platform for Comprehensive Care of Patients with Chagas Disease; BoliviaFil: Quechover, Roxana Challapa. Platform for Comprehensive Care of Patients with Chagas Disease; BoliviaFil: Caballero, Maria Yurly Escobar. Platform for Comprehensive Care of Patients with Chagas Disease; BoliviaFil: Lozano Beltran, Daniel Franz. Platform for Comprehensive Care of Patients with Chagas Disease; BoliviaFil: Zalabar, Albert Mendoza. Platform for Comprehensive Care of Patients with Chagas Disease; BoliviaFil: Rojas Panozo, Lizeth. Platform for Comprehensive Care of Patients with Chagas Disease; BoliviaFil: Palacios Lopez, Alejandro. Platform for Comprehensive Care of Patients with Chagas Disease; BoliviaFil: Torrico Terceros, Dunia. Platform for Comprehensive Care of Patients with Chagas Disease; BoliviaFil: Fernandez Galvez, Violeta Alejandra. Platform for Comprehensive Care of Patients with Chagas Disease; BoliviaFil: Cardozo, Letty. Platform for Comprehensive Care of Patients with Chagas Disease; BoliviaFil: Cuellar, Gabriela. Platform for Comprehensive Care of Patients with Chagas Disease; BoliviaFil: Vasco Arenas, Rudy Nelson. Platform for Comprehensive Care of Patients with Chagas Disease; BoliviaFil: Gonzales, Isabel. Platform for Comprehensive Care of Patients with Chagas Disease; BoliviaFil: Hoyos Delfin, Carlos Florencio. Universidad Juan Misael Saracho; BoliviaFil: Garcia, Lineth. Universidad Mayor de San Simón; BoliviaFil: Parrado, Rudy. Universidad Mayor de San Simón; BoliviaFil: de la Barra, Anabelle. Universidad Mayor de San Simón; BoliviaFil: Montaño, Nair. Universidad Mayor de San Simón; BoliviaFil: Villarroel, Sandro. Universidad Mayor de San Simón; BoliviaFil: Duffy, Tomás. Consejo Nacional de Investigaciones Científicas y Técnicas. Instituto de Investigaciones en Ingeniería Genética y Biología Molecular "Dr. Héctor N. Torres"; ArgentinaFil: Bisio, Margarita María Catalina. Consejo Nacional de Investigaciones Científicas y Técnicas. Instituto de Investigaciones en Ingeniería Genética y Biología Molecular "Dr. Héctor N. Torres"; ArgentinaFil: Ramirez Gomez, Juan Carlos. Consejo Nacional de Investigaciones Científicas y Técnicas. Instituto de Investigaciones en Ingeniería Genética y Biología Molecular "Dr. Héctor N. Torres"; ArgentinaFil: Duncanson, Fred. Eisai; JapónFil: Everson, Michael. Eisai; JapónFil: Daniels, Antonia. Eisai; JapónFil: Asada, Makoto. Eisai; JapónFil: Cox, Eugene. Quantitative Solutions; Países BajosFil: Wesche, David. Quantitative Solutions; Países BajosFil: Diderichsen, Paul Matthias. Quantitative Solutions; Países BajosFil: Marques, Alexandre F. Universidade Federal de Minas Gerais; BrasilFil: Izquierdo, Luis. ISGlobal; EspañaFil: Sender, Silvia Sanz. ISGlobal; EspañaFil: Reverter, Joan Carlos. Hospital Clinic Barcelona; EspañaFil: Morales, Manuel. Hospital Clinic Barcelona; EspañaFil: Jimenez, Wladimiro. Hospital Clinic Barcelona; Españ